PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0066300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 678aa    MW: 72280.2 Da    PI: 5.9409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0066300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-08340381346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE e + +   ++G++ +++Ia+ +  ++t  +c+++++k
   Spipo6G0066300 340 PWTAEERETFMRMLSLFGKD-FAKIASAIA-HKTTADCVEFYYK 381
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding25.72.6e-08527566445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      WT eE  ++v av   G + ++ I+ ++g +R+++qc+ ++ 
   Spipo6G0066300 527 WTDEEKSRFVAAVSCSGRD-FSGISLRVG-TRSEEQCRVFFS 566
                      *****************77.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-13325386IPR009057Homeodomain-like
PROSITE profilePS5129315.365336387IPR017884SANT domain
SMARTSM007174.7E-9337385IPR001005SANT/Myb domain
PfamPF002491.6E-6339381IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-6339384IPR009057Homeodomain-like
CDDcd001671.68E-7340382No hitNo description
PROSITE profilePS5129310.167522573IPR017884SANT domain
SMARTSM007174.3E-5523571IPR001005SANT/Myb domain
SuperFamilySSF466892.39E-7525573IPR009057Homeodomain-like
PfamPF002496.6E-7526566IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-4526568IPR009057Homeodomain-like
CDDcd001672.70E-5527565No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MALASAAPPL PRFGRGSAPM ATETSPLFPL GLRCQQDDSI TSAQSSSAKF ILSDSSPKIT  60
ALPGSVSPVT LSPATCSSFQ GQRTMSQLLL LKSAISKQLE KIESAIDLSE NEWKKLNLES  120
ERINPCPKSS KMLNDDSTQH LAEFIGEASG HCTSMVASGA TSLGWNDHPF EQAKVVKELD  180
IRTPDAVGCQ SFHSEPVEKE ACDNDTLRTA DFGGASSFTS DADQPSVIGS KPITMSGIAG  240
APALGNNSAS KKYDHEHYDT VALIMDCNSA PVPTMEAPDF MGGGAAALLA NSRPKIYRAE  300
LRMPALILEE DERIWSRFMT SNGRVEDPCS LEKERTMINP WTAEERETFM RMLSLFGKDF  360
AKIASAIAHK TTADCVEFYY KNHKSESFRE VRRSLILRKQ QQQQKGTAAP AAPARSYLLL  420
SGRRLKPASA LDSLVVPPIR GTGLQQKPRR GVRKSTPEAA AAAATKEFEP PVAAAAAAAA  480
AAVAPPSSEA VSSCVTTSLD TARMDWQVVD EGACSDEGCS EAGTADWTDE EKSRFVAAVS  540
CSGRDFSGIS LRVGTRSEEQ CRVFFSKARK SLGLDRLIPL PPPPPPPAGD QSGNSGSGGE  600
PDDGCVVEMD SAPASAGAPP GQGREDVDIR LFGQILQRQR APMRGDGAPR GPDDALSESQ  660
QPRAFTAKYS RAKPANH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545420.0AC254542.1 Spirodela polyrhiza clone GNAS837-C05, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-39MYB family protein